PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.03G189400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family SBP
Protein Properties Length: 771aa    MW: 86465.5 Da    PI: 6.8509
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.03G189400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP116.91e-36127204178
                          --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                  SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                          +Cqv+gCead+se+k yh+rh+vC  +++a++v+++g+++r+CqqC++fh ls+fDe+krsCrr+L++hn+rrr+k++
  Manes.03G189400.1.p 127 RCQVPGCEADISELKGYHKRHRVCLRCANASSVVLDGESKRYCQQCGKFHLLSDFDEGKRSCRRKLERHNNRRRRKSH 204
                          6*************************************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.105.6E-29122189IPR004333Transcription factor, SBP-box
PROSITE profilePS5114129.889125202IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.09E-33126205IPR004333Transcription factor, SBP-box
PfamPF031101.1E-27128202IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0055070Biological Processcopper ion homeostasis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 771 aa     Download sequence    Send to blast
METSSPTSPG APRPMLHDME IRPPMFEDPS SSALWDWGDL LDFTVDDQFP ISFDSVDDST  60
NIEVNHIEAT PVPDRVRKRD PRLTCSNFLA GRVPCACPEL DEKLEEEEVV PGKKRARTTR  120
STAGVARCQV PGCEADISEL KGYHKRHRVC LRCANASSVV LDGESKRYCQ QCGKFHLLSD  180
FDEGKRSCRR KLERHNNRRR RKSHDSKGAA DKEPQRELLS EDAACDGEAG KDCQIVEKEA  240
MVESEDGNIS SLHSAPNSQN VNSDSGLSVG SPNPKDGVKD DSKFLHSPFN CDNKSSYSSV  300
CPTGRISFKL YDWNPAEFPR RLRHQIFEWL ASMPVELEGY VRPGCTILTA FLSMPTFMWA  360
KLFEDPVSYV HDFVITPGKM LSKRSPMLVY LNNMIFRVMQ DGNSVLKVNL EGQAPRLHYV  420
HPSCFEAGKP IEFVACGSNL LQPKFRLLVS FAGKYLKYDY CVALPRGPTE GCSSLDHQLC  480
KIYIPHVDPN VFGPAFIEVE NESGLSNFIP VLIGNEEICS EMERIQHRLD SSQQASGSQC  540
KVSTHRQMAF SELVVDIAWL IKKPSLESFQ QKMSSSQIQR LNSLLNFLLH HESAAILDKI  600
LQNLKIILDE MEKKRVLYGI SDSDMSLLQK HMDSASNILQ QKVKQSDDVD ERDFRGCSES  660
DMPSVASFNN EDLEKSSNGK LGIMENSSAV VKSDRIPLLS KDVVMNVNLS KERPNKSCSL  720
VFSNRLMKSR PAIFLIATFT ICLGVCAILV HPNQVSKFAV SIRRCLTDRF *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul5_A3e-44125210388squamosa promoter binding protein-like 7
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1188200RRKLERHNNRRRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00604PBMTransfer from AT5G18830Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012069441.10.0PREDICTED: squamosa promoter-binding-like protein 7 isoform X1
SwissprotQ8S9G80.0SPL7_ARATH; Squamosa promoter-binding-like protein 7
TrEMBLA0A067KYI10.0A0A067KYI1_JATCU; Uncharacterized protein
STRINGPOPTR_0008s20160.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF64703450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18830.10.0squamosa promoter binding protein-like 7